Recombinant Caenorhabditis elegans Dauer larva development regulatory growth factor daf-7 (daf-7)

CAT:
399-GTR04828331
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Caenorhabditis elegans Dauer larva development regulatory growth factor daf-7 (daf-7)

  • Product Name Alternative:

    (Abnormal dauer formation protein 7)

  • Abbreviation:

    Recombinant Caenorhabditis elegans daf-7 protein

  • Gene Name:

    Daf-7

  • UniProt:

    P92172

  • Expression Region:

    235-350aa

  • Organism:

    Caenorhabditis elegans

  • Target Sequence:

    SHAKPVCNAEAQSKGCCLYDLEIEFEKIGWDWIVAPPRYNAYMCRGDCHYNAHHFNLAETGHSKIMRAAHKVSNPEIGYCCHPTEYDYIKLIYVNRDGRVSIANVNGMIAKKCGCS

  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged

  • Type:

    Developed Protein

  • Source:

    E.coli

  • Field of Research:

    Others

  • Relevance:

    Under harsh environmental conditions, larvae enter a developmentally arrested state known as dauer; TGF-beta-like daf-7 acts to inhibit dauer larva formation and promote growth. May be a ligand to cell surface receptor daf-4. May act as a negative regulator of dauer larva development by transducing chemosensory information from ASI neurons. Involved in sensitivity to CO2 levels. Involved in mate searching behavior of males, acting in concert with the neuropeptide pdf-1. In AWC neurons, acts to promote expression of srsx-3, a member of the GPCR family.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    18.1 kDa

  • References & Citations:

    "The homeodomain protein hmbx-1 maintains asymmetric gene expression in adult C. elegans olfactory neurons." Lesch B.J., Bargmann C.I. Genes Dev. 24:1802-1815 (2010)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length of Mature Protein