Recombinant Human Tumor necrosis factor receptor superfamily member 9 (TNFRSF9), partial (Active)

• Product Name Alternative:

  CD137; ILA; TNFRSF9;4-1BB ligand receptor; CDw137; T-cell antigen 4-1BB homolog; T-cell antigen ILA

• Abbreviation:

  Recombinant Human TNFRSF9 protein, partial (Active)

• Gene Name:

  TNFRSF9

• UniProt:

  Q07011

• Expression Region:

  24-186aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ

• Tag:

  C-terminal 6xHis-Fc-tagged

• Type:

  Active Protein & In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Cancer

• Relevance:

  Tumor necrosis factor receptor superfamily member 9 (TNFRSF9) is an inducible T cell surface protein belonging to the TNF receptor superfamily. It is a single-pass type I membrane protein which contains 4 TNFR-Cys repeats. The human and mouse proteins share 60% amino acid sequence identity. It is absent from naive T cells, but upregulated and continually expressed following T cell activation. It is a receptor for TNFSF9/4-1BBL, and possibly active during T cell activation.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  Measured by its binding ability in a functional ELISA. Immobilized Human 4-1BB-Fc-His at 2μg/ml can bind Anti-Human CD137 mAb, the ED50 of Anti-Human CD137 mAb is 0.41ug/ml.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.

• Molecular Weight:

  44 kDa

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Extracellular Domain