Recombinant Dendroaspis angusticeps Natriuretic peptide DNP

CAT:
399-GTR04836721
Size:
100 µg

For Laboratory Research Only. Not for Clinical or Personal Use.

  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Dendroaspis angusticeps Natriuretic peptide DNP

  • Abbreviation:

    Recombinant Dendroaspis angusticeps Natriuretic peptide DNP protein

  • UniProt:

    P28374

  • Expression Region:

    1-38aa

  • Organism:

    Dendroaspis angusticeps (Eastern green mamba) (Naja angusticeps)

  • Target Sequence:

    EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA

  • Tag:

    C-terminal 6xHis-tagged

  • Type:

    Developed Protein

  • Source:

    Yeast

  • Field of Research:

    Others

  • Relevance:

    Exhibits vasodilator, natriuretic and diuretic properties in animal models and human tissues. Acts by stimulating cGMP via the natriuretic peptide receptor A (NPR1) . Is a poor agonist of the atrial natriuretic peptide receptor B (NPR2) . Is not degraded by neutral endopeptidase (NEP/MME) . Binds to atrial natriuretic peptide clearance receptor (NPR-C/NPR3), which may be responsible of the removal of DNP from the circulation. Increases calcium uptake and induces histamine release from rat peritoneal mast cells. Increases calcium-activated potassium (KCa) current in gastric antral circular smooth muscle cells by increasing cGMP production and activating inositol trisphosphate receptors (IP3Rs) .

  • Endotoxin:

    Not test

  • Purity:

    Greater than 95% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    5.7 kDa

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length