Recombinant Dendroaspis polylepis polylepis Kunitz-type serine protease inhibitor dendrotoxin E

CAT:
399-GTR04834880
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Dendroaspis polylepis polylepis Kunitz-type serine protease inhibitor dendrotoxin E

  • Product Name Alternative:

    (DTX-E) (Venom basic protease inhibitor E)

  • Abbreviation:

    Recombinant Dendroaspis polylepis polylepis DTX-E protein

  • UniProt:

    P00984

  • Expression Region:

    1-59aa

  • Organism:

    Dendroaspis polylepis polylepis (Black mamba)

  • Target Sequence:

    LQHRTFCKLPAEPGPCKASIPAFYYNWAAKKCQLFHYGGCKGNANRFSTIEKCRHACVG

  • Tag:

    C-terminal 6xHis-tagged

  • Type:

    Developed Protein

  • Source:

    Yeast

  • Field of Research:

    Others

  • Relevance:

    Serine protease inhibitor that inhibits trypsin (Kd=1 nM) and chymotrypsin (Kd=100 nM) . May also inhibit voltage-gated potassium channels (Kv) . Binds transition metal ions such as copper and cobalt.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    8.1 kDa

  • References & Citations:

    "Snake venoms. The amino-acid sequence of trypsin inhibitor E of Dendroaspis polylepis polylepis (black mamba) venom." Joubert F.J., Strydom D.J. Eur. J. Biochem. 87:191-198 (1978)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length