Recombinant Human herpesvirus 8 type P Viral macrophage inflammatory protein 2 (VMI2), partial (Active)

• Product Name Alternative:

  Viral macrophage inflammatory protein II Short name:vMIP-II vMIP-1B

• Abbreviation:

  Recombinant Human herpesvirus 8 type P ORF K4 protein, partial (Active)

• Gene Name:

  ORF K4

• UniProt:

  Q98157

• Expression Region:

  24-93aa

• Organism:

  Human herpesvirus 8 type P (isolate GK18) (HHV-8) (Kaposi's sarcoma-associated herpesvirus)

• Target Sequence:

  LGASWHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTA

• Tag:

  Tag-Free

• Type:

  Active Protein & In Stock Protein

• Source:

  E.Coli

• Field of Research:

  Immunology

• Relevance:

  Blocks infection by several different human immunodeficiency virus type 1 (HIV-1) strains. This occurs because vMIP-II binds to a wide range of chemokine receptors. May form part of the response to host defenses contributing to virus-induced neoplasia and may have relevance to KSHV and HIV-I interactions.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  >97% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  Fully biologically active when compared to standard. The specific activity is determined by the inhibitory effect on monocyte migration response to human MIP-1 alpha using a concentration range of 1.0µg-10.0µg/ml of viral MIP-2 will inhibit 25ng/ml of human MIP-1 alpha.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 µm filtered PBS, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Blocks infection by several different human immunodeficiency virus type 1 (HIV-1) strains. This occurs because vMIP-II binds to a wide range of chemokine receptors. May form part of the response to host defenses contributing to virus-induced neoplasia and may have relevance to KSHV and HIV-I interactions.

• Molecular Weight:

  8.0 kDa

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial