Recombinant Sesamum indicum Oleosin L

CAT:
399-GTR04794987
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Sesamum indicum Oleosin L

  • Product Name Alternative:

    (Allergen Ses i 5) (Oleosin 15 kDa) (allergen Ses i 5.0101)

  • Abbreviation:

    Recombinant Sesamum indicum Oleosin L protein

  • UniProt:

    Q9XHP2

  • Expression Region:

    1-145aa

  • Organism:

    Sesamum indicum (Oriental sesame) (Sesamum orientale)

  • Target Sequence:

    MAEHYGQQQQTRAPHLQLQPRAQRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLLVIFSPVLVPAVITIFLLGAGFLASGGFGVAALSVLSWIYRYLTGKHPPGADQLESAKTKLASKAREMKDRAEQFSQQPVAGSQTS

  • Tag:

    N-terminal 10xHis-tagged

  • Type:

    CF Transmembrane Protein & In Stock Protein

  • Source:

    In vitro E.coli expression system

  • Field of Research:

    Others

  • Relevance:

    May have a structural role to stabilize the lipid body during desiccation of the seed by preventing coalescence of the oil. Probably interacts with both lipid and phospholipid moieties of lipid bodies. May also provide recognition signals for specific lipase anchorage in lipolysis during seedling growth.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    16.7 kDa

  • References & Citations:

    "Gene family of oleosin isoforms and their structural stabilization in sesame seed oil bodies." Tai S.S., Chen M.C., Peng C.C., Tzen J.T. Biosci. Biotechnol. Biochem. 66:2146-2153 (2002)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length