Recombinant Mouse Pro-neuropeptide Y (Npy), partial

• Product Name Alternative:

  Pro-neuropeptide Y [Cleaved into: Neuropeptide Y (Neuropeptide tyrosine) (NPY) ; C-flanking peptide of NPY (CPON) ]

• Abbreviation:

  Recombinant Mouse Npy protein, partial

• Gene Name:

  Npy

• UniProt:

  P57774

• Expression Region:

  29-64aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY

• Tag:

  N-terminal hFc-tagged

• Type:

  In Stock Protein

• Source:

  Yeast

• Field of Research:

  Neuroscience

• Relevance:

  NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  30.9 kDa

• References & Citations:

  "Behavioral characterization of neuropeptide Y knockout mice." Bannon A.W., Seda J., Carmouche M., Francis J.M., Norman M.H., Karbon B., McCaleb M.L. Brain Res 868:79-87 (2000)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial