Recombinant Mouse Pro-neuropeptide Y (Npy), partial

CAT:
399-GTR04827351
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Mouse Pro-neuropeptide Y (Npy), partial

  • Product Name Alternative:

    Pro-neuropeptide Y [Cleaved into: Neuropeptide Y (Neuropeptide tyrosine) (NPY) ; C-flanking peptide of NPY (CPON) ]

  • Abbreviation:

    Recombinant Mouse Npy protein, partial

  • Gene Name:

    Npy

  • UniProt:

    P57774

  • Expression Region:

    29-64aa

  • Organism:

    Mus musculus (Mouse)

  • Target Sequence:

    YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY

  • Tag:

    N-terminal hFc-tagged

  • Type:

    In Stock Protein

  • Source:

    Yeast

  • Field of Research:

    Neuroscience

  • Relevance:

    NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    30.9 kDa

  • References & Citations:

    "Behavioral characterization of neuropeptide Y knockout mice." Bannon A.W., Seda J., Carmouche M., Francis J.M., Norman M.H., Karbon B., McCaleb M.L. Brain Res 868:79-87 (2000)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial