Recombinant Human Tumor necrosis factor receptor superfamily member 4 (TNFRSF4), partial (Active)

• Product Name Alternative:

  Tumor necrosis factor receptor superfamily member 4; ACT35 antigen; OX40L receptor; TAX transcriptionally-activated glycoprotein 1 receptor; TNFRSF4; OX40; CD134; Txgp1

• Abbreviation:

  Recombinant Human TNFRSF4 protein, partial (Active)

• Gene Name:

  TNFRSF4

• UniProt:

  P43489

• Expression Region:

  29-216aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA

• Tag:

  C-terminal Fc-tagged

• Type:

  Active Protein & In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Cancer

• Relevance:

  OX40, also termed CD134 and TNFRSF4, is a T cell co-stimulatory molecule of the TNF receptor superfamily which plays a key role in the survival and homeostasis of effector and memory T cells. OX40 is expressed on CD4+ and CD8+ T cells upon engagement of the TCR by antigen presenting cells along with co-stimulation by CD40-CD40 Ligand and CD28-B7. The interaction between OX40 and OX40 ligand (OX40L) will occur when activated T cells bind to professional antigen-presenting cells (APCs) . The T-cell functions, including cytokine production, expansion, and survival, are then enhanced by the OX40 costimulatory signals. OX40 signals are critical for controlling the function and differentiation of Foxp3+ regulatory T cells. OX40-OX40L interaction regulates T-cell tolerance, peripheral T-cell homeostasis, and T-cell-mediated inflammatory diseases.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  ①Loaded Biotinylated Human OX40L-His on AR2G Biosensor, can bind Human OX40-Fc with an affinity constant of 70.3 nM as determined in BLI assay. ②Loaded Cynomolgus OX40L-His on HIS1K Biosensor, can bind Human OX40-Fc with an affinity constant of 165nM as determined in BLI assay.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity.

• Molecular Weight:

  46.8 kDa

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial