Recombinant Human C-C chemokine receptor type 8 (CCR8), partial

CAT:
399-GTR04826053
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human C-C chemokine receptor type 8 (CCR8), partial

  • Product Name Alternative:

    C-C chemokine receptor type 8 (C-C CKR-8) (CC-CKR-8) (CCR-8) (CC chemokine receptor CHEMR1) (CMKBRL2) (Chemokine receptor-like 1) (CKR-L1) (GPR-CY6) (GPRCY6) (TER1) (CD antigen CDw198)

  • Abbreviation:

    Recombinant Human CCR8 protein, partial

  • Gene Name:

    CCR8

  • UniProt:

    P51685

  • Expression Region:

    1-35aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    MDYTLDLSVTTVTDYYYPDIFSSPCDAELIQTNGK

  • Tag:

    C-terminal 6xHis-Myc-tagged

  • Type:

    Developed Protein

  • Source:

    Yeast

  • Field of Research:

    G-protein coupled receptor, Receptor, Transducer

  • Relevance:

    Receptor for the chemokine CCL1/SCYA1/I-309. May regulate monocyte chemotaxis and thymic cell line apoptosis. Alternative coreceptor with CD4 for HIV-1 infection.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    7.7 kDa

  • References & Citations:

    "The assignment of chemokine-chemokine receptor pairs: TARC and MIP-1 beta are not ligands for human CC-chemokine receptor 8." Garlisi C.G., Xiao H., Tian F., Hedrick J.A., Billah M.M., Egan R.W., Umland S.P. Eur. J. Immunol. 29:3210-3215 (1999)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial