Recombinant Human Transcription factor A, mitochondrial (TFAM)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
Recombinant Human Transcription factor A, mitochondrial (TFAM)
Product Name Alternative:
(mtTFA) (Mitochondrial transcription factor 1) (MtTF1) (Transcription factor 6) (TCF-6) (Transcription factor 6-like 2)
Abbreviation:
Recombinant Human TFAM protein
Gene Name:
TFAM
UniProt:
Q00059
Expression Region:
43-246aa
Organism:
Homo sapiens (Human)
Target Sequence:
SSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC
Tag:
N-terminal 6xHis-tagged
Type:
Developed Protein
Source:
E.coli
Field of Research:
Cardiovascular
Relevance:
Binds to the mitochondrial light strand promoter and functions in mitochondrial transcription regulation . Component of the mitochondrial transcription initiation complex, composed at least of TFB2M, TFAM and POLRMT that is required for basal transcription of mitochondrial DNA . In this complex, TFAM recruits POLRMT to a specific promoter whereas TFB2M induces structural changes in POLRMT to enable promoter opening and trapping of the DNA non-template strand . Required for accurate and efficient promoter recognition by the mitochondrial RNA polymerase . Promotes transcription initiation from the HSP1 and the light strand promoter by binding immediately upstream of transcriptional start sites . Is able to unwind DNA . Bends the mitochondrial light strand promoter DNA into a U-turn shape via its HMG boxes . Required for maintenance of normal levels of mitochondrial DNA . May play a role in organizing and compacting mitochondrial DNA .
Endotoxin:
Not test
Purity:
Greater than 90% as determined by SDS-PAGE.
Activity:
Not Test
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight:
28.5 kDa
References & Citations:
"Human mitochondrial transcription factor A induces a U-turn structure in the light strand promoter." Rubio-Cosials A., Sidow J.F., Jimenez-Menendez N., Fernandez-Millan P., Montoya J., Jacobs H.T., Coll M., Bernado P., Sola M. Nat. Struct. Mol. Biol. 18:1281-1289 (2011)
Storage Conditions:
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length:
Full Length of Mature Protein