Recombinant Human Anoctamin-5 (ANO5), partial

CAT:
399-GTR04836926
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Anoctamin-5 (ANO5), partial

  • Product Name Alternative:

    (Gnathodiaphyseal dysplasia 1 protein) (Transmembrane protein 16E)

  • Abbreviation:

    Recombinant Human ANO5 protein, partial

  • Gene Name:

    ANO5

  • UniProt:

    Q75V66

  • Expression Region:

    1-299aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    MGDPDLLEVLAEEGEKVNKHIDYSFQMSEQSLSSRETSFLINEETMPAKRFNLFLRRRLMFQKNQQSKDSIFFRDGIRQIDFVLSYVDDVKKDAELKAERRKEFETNLRKTGLELEIEDKRDSEDGRTYFVKIHAPWEVLVTYAEVLGIKMPIKESDIPRPKHTPISYVLGPVRLPLSVKYPHPEYFTAQFSRHRQELFLIEDQATFFPSSSRNRIVYYILSRCPFGIEDGKKRFGIERLLNSNTYSSAYPLHDGQYWKPSEPPNPTNERYTLHQNWARFSYFYKEQPLDLIKNYYGEK

  • Tag:

    C-terminal 10xHis-tagged

  • Type:

    In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Others

  • Relevance:

    Does not exhibit calcium-activated chloride channel (CaCC) activity.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    39.0 kDa

  • References & Citations:

    "A novel missense mutation in ANO5/TMEM16E is causative for gnathodiaphyseal dyplasia in a large Italian pedigree." Marconi C., Brunamonti Binello P., Badiali G., Caci E., Cusano R., Garibaldi J., Pippucci T., Merlini A., Marchetti C., Rhoden K.J., Galietta L.J., Lalatta F., Balbi P., Seri M. Eur. J. Hum. Genet. 21:613-619 (2013)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial