Recombinant Mouse C-X-C chemokine receptor type 3 (Cxcr3), partial

• Product Name Alternative:

  Interferon-inducible protein 10 receptor (IP-10 receptor) (CD_antigen: CD183) (CXC-R3) (CXCR-3) (Cmkar3)

• Abbreviation:

  Recombinant Mouse Cxcr3 protein, partial

• Gene Name:

  Cxcr3

• UniProt:

  O88410

• Expression Region:

  1-52aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  MYLEVSERQVLDASDFAFLLENSTSPYDYGENESDFSDSPPCPQDFSLNFDR

• Tag:

  N-terminal 6xHis-KSI-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Cardiovascular

• Relevance:

  Receptor for the C-X-C chemokine CXCL9, CXCL10 and CXCL11 and mediates the proliferation, survival and angiogenic activity of mesangial cells through a heterotrimeric G-protein signaling pathway. Probably promotes cell chemotaxis response.

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  21.3 kDa

• References & Citations:

  "Cloning of the murine interferon-inducible protein 10 (IP-10) receptor and its specific expression in lymphoid organs." Tamaru M., Tominaga Y., Yatunami K., Narumi S. Biochem. Biophys. Res. Commun. 251:41-48 (1998)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial