Recombinant Mouse C-X-C motif chemokine 15 (Cxcl15)

CAT:
399-GTR04834388
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Mouse C-X-C motif chemokine 15 (Cxcl15)

  • Product Name Alternative:

    (Lungkine) (Small-inducible cytokine B15)

  • Abbreviation:

    Recombinant Mouse Cxcl15 protein

  • Gene Name:

    Cxcl15

  • UniProt:

    Q9WVL7

  • Expression Region:

    26-167aa

  • Organism:

    Mus musculus (Mouse)

  • Target Sequence:

    QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDA

  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged

  • Type:

    Developed Protein

  • Source:

    E.coli

  • Field of Research:

    Immunology

  • Relevance:

    Chemotactic for neutrophils. Involved in lung-specific neutrophil trafficking during normal and inflammatory conditions.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    23.8 kDa

  • References & Citations:

    "Impaired pulmonary host defense in mice lacking expression of the CXC chemokine lungkine." Chen S.C., Mehrad B., Deng J.C., Vassileva G., Manfra D.J., Cook D.N., Wiekowski M.T., Zlotnik A., Standiford T.J., Lira S.A. J. Immunol. 166:3362-3368 (2001)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length of Mature Protein