Recombinant Rat Uroplakin-1b (Upk1b)

CAT:
399-GTR04791425
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Rat Uroplakin-1b (Upk1b)

  • Product Name Alternative:

    UP1b; Uroplakin Ib; UPIb

  • Abbreviation:

    Recombinant Rat Upk1b protein

  • Gene Name:

    Upk1b

  • UniProt:

    Q566D0

  • Expression Region:

    1-260aa

  • Organism:

    Rattus norvegicus (Rat)

  • Target Sequence:

    MAKDDSTVRCFQGLLIFGHVIVGMCGIALTAECIFFVSDQHSLYPLLEATNNDDIFGAAWIGMFVGICLFCLSVLAIVGIMKSNRKILLAYFIMMFIVYGFEVASCITAATQRDFFTTNLFLKQMLMRYQNNSPPTNDDKWKNSYVTKTWDRLMLQDHCCGVNGPSDWQKYTSAFRVENSDADYPWPRQCCVMDKLQEPLNLDACKLGVPGYYHSQGCYELISGPMDRHAWGVAWFGFAILCWTFWVLLGTMFYWSRIEY

  • Tag:

    N-terminal 10xHis-tagged

  • Type:

    CF Transmembrane Protein & In Stock Protein

  • Source:

    In vitro E.coli expression system

  • Field of Research:

    Signal Transduction

  • Relevance:

    Component of the asymmetric unit membrane (AUM) ; a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in normal bladder epithelial physiology, possibly in regulating membrane permeability of superficial umbrella cells or in stabilizing the apical membrane through AUM/cytoskeletal interactions.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    31.2 kDa

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length