Recombinant Mouse Atrial natriuretic peptide receptor 1 (Npr1), partial

• Product Name Alternative:

  Atrial natriuretic peptide receptor 1; EC:4.6.1.2; Atrial natriuretic peptide receptor type A (ANP-A; ANPR-A; NPR-A) ; Guanylate cyclase A (GC-A)

• Abbreviation:

  Recombinant Mouse NPR1 protein, partial

• Gene Name:

  NPR1

• UniProt:

  P18293

• Expression Region:

  29-469aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  SDLTVAVVLPLTNTSYPWSWARVGPAVELALGRVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLAAVDLKWEHSPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGAPALGIGVKDEYALTTRTGPSHVKLGDFVTALHRRLGWEHQALVLYADRLGDDRPCFFIVEGLYMRVRERLNITVNHQEFVEGDPDHYTKLLRTVQRKGRVIYICSSPDAFRNLMLLALDAGLTGEDYVFFHLDVFGQSLQGAQGPVPRKPWERDDGQDRRARQAFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTMEDGLKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGDRDTDFSLWDMDPETGAFRVVLNFNGTSQELMAVSEHRLYWPLGYPPPDIPKCGFDNEDPACNQDHFSTLE

• Tag:

  C-terminal 10xHis-tagged

• Type:

  In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Others

• Relevance:

  Receptor for the atrial natriuretic peptide NPPA/ANP and the brain natriuretic peptide NPPB/BNP which are potent vasoactive hormones playing a key role in cardiovascular homeostasis. Has guanylate cyclase activity upon binding of the ligand.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  50.7 kDa

• References & Citations:

  Retinal degeneration protein 3 controls membrane guanylate cyclase activities in brain tissue. Chen Y., Brauer A.U., Koch K.W. Front Mol Neurosci 15:1076430-1076430 (2022)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial