Recombinant Gymnema sylvestre Gurmarin

CAT:
399-GTR04837404
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Gymnema sylvestre Gurmarin

  • Product Name Alternative:

    (Sweet taste-suppressing peptide)

  • Abbreviation:

    Recombinant Gymnema sylvestre Gurmarin protein

  • UniProt:

    P25810

  • Expression Region:

    1-35aa

  • Organism:

    Gymnema sylvestre (Gurmar) (Periploca sylvestris)

  • Target Sequence:

    QQCVKKDELCIPYYLDCCEPLECKKVNWWDHKCIG

  • Tag:

    N-terminal 6xHis-KSI-tagged

  • Type:

    Developed Protein

  • Source:

    E.coli

  • Field of Research:

    Others

  • Relevance:

    Suppresses strongly the sweet taste responses in the rat with high specificity to sucrose, glucose, glycine, and saccharin. This effect is reversible, but complete recovery of the suppressed responses required at least 3h. Gurmarin showed no effect or only a very weak effect on the sweet taste sensation in humans.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    19.6 kDa

  • References & Citations:

    "High-resolution solution structure of gurmarin, a sweet-taste-suppressing plant polypeptide." Fletcher JI, Dingley AJ, Smith R, Connor M, Christie MJ, King GF. Eur. J. Biochem. 264 525-33 (1999)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length