Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b)

CAT:
399-GTR04837561
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa (4b)

  • Product Name Alternative:

    (ns4.8) (4.8 kDa accessory protein)

  • Abbreviation:

    Recombinant Bovine coronavirus Non-structural protein of 4.8 kDa

  • Gene Name:

    4b

  • UniProt:

    P0C2R8

  • Expression Region:

    1-45aa

  • Organism:

    Bovine coronavirus (strain OK-0514) (BCoV) (BCV)

  • Target Sequence:

    MPMATTIDGTDYTNIMPITVFTTVYLGVFIGIDTSTTGFTCFSRY

  • Tag:

    N-terminal 6xHis-SUMO-tagged

  • Type:

    In Stock Protein

  • Source:

    E.coli

  • Field of Research:

    Others

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    17.9 kDa

  • References & Citations:

    "Nucleotide and predicted amino acid sequences of all genes encoded by the 3' genomic portion (9.5 kb) of respiratory bovine coronaviruses and comparisons among respiratory and enteric coronaviruses." Chouljenko V.N., Kousoulas K.G., Lin X.Q., Storz J. Virus Genes 17:33-42 (1998)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length