Recombinant Human Short transient receptor potential channel 6 (TRPC6), partial

• Product Name Alternative:

  (TrpC6) (Transient receptor protein 6) (TRP-6)

• Abbreviation:

  Recombinant Human TRPC6 protein, partial

• Gene Name:

  TRPC6

• UniProt:

  Q9Y210

• Expression Region:

  543-592aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  ARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWDPSDPQ

• Tag:

  C-terminal hFc1-tagged

• Type:

  Developed Protein

• Source:

  Mammalian cell

• Field of Research:

  Neuroscience

• Relevance:

  Thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. Activated by diacylglycerol (DAG) in a membrane-delimited fashion, independently of protein kinase C. Seems not to be activated by intracellular calcium store depletion.

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  34.7 kDa

• References & Citations:

  "TRPC6 G757D Loss-of-Function Mutation Associates with FSGS." Riehle M., Buescher A.K., Gohlke B.O., Kassmann M., Kolatsi-Joannou M., Braesen J.H., Nagel M., Becker J.U., Winyard P., Hoyer P.F., Preissner R., Krautwurst D., Gollasch M., Weber S., Harteneck C. J. Am. Soc. Nephrol. 27:2771-2783 (2016)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial