Recombinant Human Myelin-oligodendrocyte glycoprotein (MOG) -VLPs, Fluorescent

• CAS Number:

  9000-83-3

• Gene Name:

  MOG

• UniProt:

  Q16653

• Expression Region:

  30-247aa

• Organism:

  Homo sapiens

• Target Sequence:

  GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLIFLCLQYRLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFLEELRNPF

• Tag:

  C-terminal EGFP-tagged

• Source:

  Mammalian cell

• Field of Research:

  Signal Transduction

• Assay Type:

  MP-VLP Transmembrane Protein & Developed Protein

• Relevance:

  Mediates homophilic cell-cell adhesion. Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication. ; (Microbial infection) Acts as a receptor for rubella virus.

• Purity:

  The purity information is not available for VLPs proteins.

• Activity:

  Not Test

• Length:

  Full Length of Mature Protein

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle miXIng. Avoid vigorous shaking or vorteXIng.

• Molecular Weight:

  55.9 kDa

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.