Recombinant Mouse Guanine nucleotide-binding protein G (I) /G (S) /G (O) subunit gamma-12 (Gng12)

• Product Name Alternative:

  Guanine nucleotide-binding protein G (I) /G (S) /G (O) subunit gamma-12

• Abbreviation:

  Recombinant Mouse Gng12 protein

• Gene Name:

  Gng12

• UniProt:

  Q9DAS9

• Expression Region:

  2-69aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  SSKTASTNSIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLMGIPTSENPFKDKKTC

• Tag:

  N-terminal 10xHis-tagged and C-terminal Myc-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Cancer

• Relevance:

  Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  15.0 kDa

• References & Citations:

  "Disruption of G-protein gamma5 subtype causes embryonic lethality in mice." Moon A.M., Stauffer A.M., Schwindinger W.F., Sheridan K., Firment A., Robishaw J.D. PLoS One 9:e90970-e90970 (2014)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein