Recombinant Mouse EEF1A lysine methyltransferase 2 (Eef1akmt2)

• Product Name Alternative:

  EEF1A lysine methyltransferase 2 (EC 2.1.1.-) (Methyltransferase-like protein 10) (Protein-lysine N-methyltransferase Mettl10)

• Abbreviation:

  Recombinant Mouse Eef1akmt2 protein

• Gene Name:

  Eef1akmt2

• UniProt:

  Q9D853

• Expression Region:

  1-244aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  MNADAEGHSGAVVPAQSPEGSSAADDFVPSALGTREHWDAVYERELRTFQEYGDTGEIWFGEESMNRLIRWMQKHKIPLDASVLDIGTGNGVFLVELVKHGFSNITGIDYSPSAIKLSASILEKEGLSNINLKVEDFLNPSTKLSGFHVCVDKGTYDAISLNPDNAIEKRKQYVMSLSRVLEVKGFFLITSCNWTKAELLDAFSEGFELFEELPTPKFSFGGRSGNTVAALVFQKRGTSLDKIS

• Tag:

  N-terminal 10xHis-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Others

• Relevance:

  Protein-lysine methyltransferase that selectively catalyzes the trimethylation of EEF1A at 'Lys-318'.

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  32.9 kDa

• References & Citations:

  "Head bobber: an insertional mutation causes inner ear defects, hyperactive circling, and deafness." Somma G., Alger H.M., McGuire R.M., Kretlow J.D., Ruiz F.R., Yatsenko S.A., Stankiewicz P., Harrison W., Funk E., Bergamaschi A., Oghalai J.S., Mikos A.G., Overbeek P.A., Pereira F.A. J Assoc Res Otolaryngol 13:335-349 (2012)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length