Recombinant Human Aldehyde dehydrogenase X, mitochondrial (ALDH1B1), partial

• Product Name Alternative:

  (Aldehyde dehydrogenase 5) (Aldehyde dehydrogenase family 1 member B1)

• Abbreviation:

  Recombinant Human ALDH1B1 protein, partial

• Gene Name:

  ALDH1B1

• UniProt:

  P30837

• Expression Region:

  167-264aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  SRVISQPDQTLEILMSELDPAVMDQFYMKDGVTAKDVTRESGIRDLIPGSVIDATMFNPCGYSMNGMKSDGTYWTIHITPEPEFSYVSFETNLSQTSY

• Tag:

  N-terminal 10xHis-GST-tagged and C-terminal V5-Myc-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Metabolism

• Relevance:

  ALDHs play a major role in the detoxification of alcohol-derived acetaldehyde. They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation.

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  47.6 kDa

• References & Citations:

  "Aldehyde dehydrogenase 1B1: molecular cloning and characterization of a novel mitochondrial acetaldehyde-metabolizing enzyme." Stagos D., Chen Y., Brocker C., Donald E., Jackson B.C., Orlicky D.J., Thompson D.C., Vasiliou V. Drug Metab Dispos 38:1679-1687 (2010)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial