Recombinant Rat Purine nucleoside phosphorylase (Pnp)

CAT:
399-GTR04836780
Size:
10 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Rat Purine nucleoside phosphorylase (Pnp)

  • Product Name Alternative:

    (PNP) (Inosine phosphorylase) (Inosine-guanosine phosphorylase)

  • Abbreviation:

    Recombinant Rat Pnp protein

  • Gene Name:

    Pnp

  • UniProt:

    P85973

  • Expression Region:

    1-289aa

  • Organism:

    Rattus norvegicus (Rat)

  • Target Sequence:

    MENEFTYEDYQRTAEWLRSHTKHRPQVAVICGSGLGGLTAKLTQPQAFDYNEIPNFPQSTVQGHAGRLVFGFLNGRSCVMMQGRFHMYEGYSLSKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFCGQNPLRGPNDERFGVRFPAMSDAYDRDMRQKAFNAWKQMGEQRELQEGTYIMSAGPTFETVAESCLLRMLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVVMDYNNLEKASHQEVLEAGKAAAQKLEQFVSILMESIPPRERAN

  • Tag:

    C-terminal 6xHis-tagged

  • Type:

    In Stock Protein

  • Source:

    Baculovirus

  • Field of Research:

    Others

  • Relevance:

    Catalyzes the phosphorolytic breakdown of the N-glycosidic bond in the beta- (deoxy) ribonucleoside molecules, with the formation of the corresponding free purine bases and pentose-1-phosphate. Preferentially acts on 6-oxopurine nucleosides including inosine and guanosine.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    33.1 kDa

  • References & Citations:

    "Purine nucleoside phosphorylase inhibition ameliorates age-associated lower urinary tract dysfunctions." Birder L.A., Wolf-Johnston A., Wein A.J., Cheng F., Grove-Sullivan M., Kanai A.J., Watson A.M., Stoltz D., Watkins S.C., Robertson A.M., Newman D., Dmochowski R.R., Jackson E.K. JCI Insight 5:140109-140109 (2020)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length