Recombinant Bothrops atrox Zinc metalloproteinase atroxlysin-1

• Product Name Alternative:

  (SVMP) (Atroxlysin-I)

• Abbreviation:

  Recombinant Bothrops atrox Zinc metalloproteinase atroxlysin-1 protein

• UniProt:

  P85420

• Expression Region:

  1-202aa

• Organism:

  Bothrops atrox (Barba amarilla) (Fer-de-lance)

• Target Sequence:

  TPEQQRYVDLFIVVDHGMFMKYNGNSDKIRRRIHQMVNIMKEAYSTMYIDILLTGVEIWSNKDLINVQPAAPQTLDSFGEWRKTDLLNRKSHDNAQLLTSTDFNGPTIGLAYVGSMCDPKRSTGVIQDHSEQDLMVAITMAHELGHNLGISHDTGSCSCGGYSCIMSPVLSHEPSKYFSDCSYIQCWDFIMKENPQCILNKR

• Tag:

  N-terminal 10xHis-tagged and C-terminal Myc-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Others

• Relevance:

  Snake venom zinc metalloproteinase that acts on fibrinogen, fibrin, fibronectin (FN1), type I collagen, type IV collagen, integrin alpha-7/beta-1 (ITGA7/ITGB1) and integrin alpha-1/beta-1 (ITGA1/ITGB1) . Binds to fibronectin (FN1), fibrinogen and, weakly, to type I collagen and laminin. Cleaves Xaa-Leu bonds. Inhibits ADP- and collagen-induced platelet aggregation both in the presence (IC (50) =1.4 uM for collagen) and in the absence (IC (50) =2.2 uM for collagen) of cofactors. Has hemorrhagic activity.

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  30.4 kDa

• References & Citations:

  "Complete amino acid sequence of atroxlysin-I, a metalloproteinase from Peruvian Bothrops atrox (Jergon) venom." Sanchez E.F., Richardson M. Submitted (JUN-2011) .

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length