Recombinant Human Low-density lipoprotein receptor-related protein 2 (LRP2), partial

• Product Name Alternative:

  (LRP-2) (Glycoprotein 330) (gp330) (Megalin)

• Abbreviation:

  Recombinant Human LRP2 protein, partial

• Gene Name:

  LRP2

• UniProt:

  P98164

• Expression Region:

  1186-1389aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  NCTASQFKCASGDKCIGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGSDEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCLGHNICVNLSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFLLANDSKTCE

• Tag:

  C-terminal mFc-tagged

• Type:

  In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Immunology

• Relevance:

  Multiligand endocytic receptor . Acts together with CUBN to mediate endocytosis of high-density lipoproteins . Mediates receptor-mediated uptake of polybasic drugs such as aprotinin, aminoglycosides and polymyxin B . In the kidney, mediates the tubular uptake and clearance of leptin . Also mediates transport of leptin across the blood-brain barrier through endocytosis at the choroid plexus epithelium . Endocytosis of leptin in neuronal cells is required for hypothalamic leptin signaling and leptin-mediated regulation of feeding and body weight . Mediates endocytosis and subsequent lysosomal degradation of CST3 in kidney proximal tubule cells . Mediates renal uptake of 25-hydroxyvitamin D3 in complex with the vitamin D3 transporter GC/DBP . Mediates renal uptake of metallothionein-bound heavy metals . Together with CUBN, mediates renal reabsorption of myoglobin . Mediates renal uptake and subsequent lysosomal degradation of APOM . Plays a role in kidney selenium homeostasis by mediating renal endocytosis of selenoprotein SEPP1 . Mediates renal uptake of the antiapoptotic protein BIRC5/survivin which may be important for functional integrity of the kidney . Mediates renal uptake of matrix metalloproteinase MMP2 in complex with metalloproteinase inhibitor TIMP1 . Mediates endocytosis of Sonic hedgehog protein N-product (ShhN), the active product of SHH . Also mediates ShhN transcytosis . In the embryonic neuroepithelium, mediates endocytic uptake and degradation of BMP4, is required for correct SHH localization in the ventral neural tube and plays a role in patterning of the ventral telencephalon . Required at the onset of neurulation to sequester SHH on the apical surface of neuroepithelial cells of the rostral diencephalon ventral midline and to control PTCH1-dependent uptake and intracellular trafficking of SHH . During neurulation, required in neuroepithelial cells for uptake of folate bound to the folate receptor FOLR1 which is necessary for neural tube closure . In the adult brain, negatively regulates BMP signaling in the subependymal zone which enables neurogenesis to proceed . In astrocytes, mediates endocytosis of ALB which is required for the synthesis of the neurotrophic factor oleic acid . Involved in neurite branching . During optic nerve development, required for SHH-mediated migration and proliferation of oligodendrocyte precursor cells . Mediates endocytic uptake and clearance of SHH in the retinal margin which protects retinal progenitor cells from mitogenic stimuli and keeps them quiescent . Plays a role in reproductive organ development by mediating uptake in reproductive tissues of androgen and estrogen bound to the sex hormone binding protein SHBG . Mediates endocytosis of angiotensin-2 . Also mediates endocytosis of angiotensis 1-7 . Binds to the complex composed of beta-amyloid protein 40 and CLU/APOJ and mediates its endocytosis and lysosomal degradation . Required for embryonic heart development . Required for normal hearing, possibly through interaction with estrogen in the inner ear .

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  50.8 kDa

• References & Citations:

  A protein involved in calcium sensing of the human parathyroid and placental cytotrophoblast cells belongs to the LDL-receptor protein superfamily.Lundgren S., Hjaelm G., Hellman P., Ek B., Juhlin C., Rastad J., Klareskog L., Aakerstroem G., Rask L.Exp. Cell Res. 212:344-350 (1994)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial