Recombinant Human Cancer/testis antigen 1 (CTAG1A)

CAT:
399-GTR04832276
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Cancer/testis antigen 1 (CTAG1A)

  • Product Name Alternative:

    CTAG1A; CTAG1B; Autoimmunogenic cancer/testis antigen NY ESO 1; Autoimmunogenic cancer/testis antigen NY-ESO-1; Cancer antigen 3; Cancer/testis antigen 1; Cancer/testis antigen 1B ; Cancer/testis antigen 6.1; CT6.1; CTAG 1; CTAG 1B; CTAG; CTAG1; CTAG1B; CTG1B_HUMAN; ESO 1; ESO1; L antigen family member 2; LAGE 2; LAGE 2 protein; LAGE 2B; LAGE-2; LAGE2; LAGE2 protein; LAGE2A; LAGE2B; New York esophageal squamous cell carcinoma 1; NY ESO 1; NYESO 1; NYESO1

  • Abbreviation:

    Recombinant Human CTAG1A protein

  • Gene Name:

    CTAG1A

  • UniProt:

    P78358

  • Expression Region:

    1-180aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPMEAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR

  • Tag:

    C-terminal hFc1-Myc-tagged

  • Type:

    In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Others

  • Relevance:

    Autoimmunogenic cancer/testis antigen NY-ESO-1 (Cancer/testis antigen 6.1) (CT6.1) (L antigen family member 2) (LAGE-2) (CTAG) (CTAG1) (ESO1) (LAGE2) (LAGE2A)

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    48.1 kDa

  • References & Citations:

    "Multiple pathogenic and benign genomic rearrangements occur at a 35 kb duplication involving the NEMO and LAGE2 genes." Aradhya S., Bardaro T., Galgoczy P., Yamagata T., Esposito T., Patlan H., Ciccodicola A., Kenwrick S., Platzer M., D'Urso M., Nelson D.L. Hum. Mol. Genet. 10:2557-2567 (2001)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length