Recombinant Human SPARC-related modular calcium-binding protein 1 (SMOC1), partial

CAT:
399-GTR04831651
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human SPARC-related modular calcium-binding protein 1 (SMOC1), partial

  • Product Name Alternative:

    Secreted modular calcium-binding protein 1

  • Abbreviation:

    Recombinant Human SMOC1 protein, partial

  • Gene Name:

    SMOC1

  • UniProt:

    Q9H4F8

  • Expression Region:

    277-382aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    GRPLPGTSTRYVMPSCESDARAKTTEADDPFKDRELPGCPEGKKMEFITSLLDALTTDMVQAINSAAPTGGGRFSEPDPSHTLEERVVHWYFSQLDSNSSNDINKR

  • Tag:

    N-terminal 6xHis-GST-tagged

  • Type:

    In Stock Protein

  • Source:

    E.coli

  • Field of Research:

    Developmental Biology

  • Relevance:

    Plays essential roles in both eye and limb development. Probable regulator of osteoblast differentiation.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    43.2 kDa

  • References & Citations:

    "Secretome analysis of human BMSCs and identification of SMOC1 as an important ECM protein in osteoblast differentiation." Choi Y.A., Lim J., Kim K.M., Acharya B., Cho J.Y., Bae Y.C., Shin H.I., Kim S.Y., Park E.K. J. Proteome Res. 9:2946-2956 (2010)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial