Recombinant Epstein-Barr virus Protein BMRF2 (BMRF2), partial

CAT:
399-GTR04837152
Size:
200 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Epstein-Barr virus Protein BMRF2 (BMRF2), partial

  • Abbreviation:

    Recombinant Epstein-Barr virus BMRF2 protein, partial

  • Gene Name:

    BMRF2

  • UniProt:

    P03192

  • Expression Region:

    180-217aa

  • Organism:

    Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

  • Target Sequence:

    RRNQIYTSGLERRRSIFCARGDHSVASLKETLHKCPWD

  • Tag:

    N-terminal 6xHis-GST-tagged

  • Type:

    In Stock Protein

  • Source:

    E.coli

  • Field of Research:

    Others

  • Relevance:

    Facilitates virus attachment to oral epithelial cells by binding to host beta1 integrin family. Participates in rearrangement of cellular actin to increase intercellular contacts by binding BDLF2 and thereby promote virus cell-to-cell spreading.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 95% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    36.0 kDa

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial

Recombinant Epstein-Barr virus Protein BMRF2 (BMRF2), partial | Karobio