Recombinant Bunodosoma granuliferum Delta-actitoxin-Bgr2a

• Product Name Alternative:

  Delta-AITX-Bgr2a; Bg II; BgII; Neurotoxin Bg-2

• Abbreviation:

  Recombinant Bunodosoma granuliferum Delta-actitoxin-Bgr2a protein

• UniProt:

  P0C1F4

• Expression Region:

  1-48aa

• Organism:

  Bunodosoma granuliferum (Red warty sea anemone)

• Target Sequence:

  GASCRCDSDGPTSRGNTLTGTLWLIGRCPSGWHNCRGSGPFIGYCCKQ

• Tag:

  N-terminal GST-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Others

• Relevance:

  Binds voltage-dependently at site 3 of sodium channels (Nav) and inhibits the inactivation of the activated channels, thereby blocking neuronal transmission. Possesses the highest efficacy for the insect sodium channel para/tipE (EC (50) =5.5 nM), and has effect on Nav1.2/SCN2A (in complex with SCN1B), Nav1.4/SCN4A (in complex with SCN1B) and Nav1.5/SCN5A (in complex with SCN1B.

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Bioactivity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  31.8 kDa

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length