Recombinant Human Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform (PPP2CB)

CAT:
399-GTR04835508
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform (PPP2CB)

  • Product Name Alternative:

    PP2A beta; PP2A-beta; PP2AB_HUMAN; PP2Abeta; PP2CB; Ppp2cb; Protein phosphatase 2 (formerly 2A) ; catalytic subunit; beta isoform; Protein phosphatase 2 catalytic subunit beta isozyme; Protein phosphatase 2; catalytic subunit; beta isoform; Protein phosphatase 2A catalytic subunit beta isoform; Protein phosphatase type 2A catalytic subunit; Serine/threonine protein phosphatase 2A catalytic subunit beta; Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform

  • Abbreviation:

    Recombinant Human PPP2CB protein

  • Gene Name:

    PPP2CB

  • UniProt:

    P62714

  • Expression Region:

    1-309aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL

  • Tag:

    N-terminal GST-tagged

  • Type:

    Developed Protein

  • Source:

    E.coli

  • Field of Research:

    Signal Transduction

  • Relevance:

    PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Function:

    PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase.

  • Molecular Weight:

    62.6 kDa

  • References & Citations:

    The nucleotide sequence of the cDNA encoding the human lung protein phosphatase 2A beta catalytic subunit.Hemmings B.A., Wernet W., Mayer R., Maurer F., Hofsteenge J., Stone S.R.Nucleic Acids Res. 16:11366-11366 (1988)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length