Recombinant Human Desert hedgehog protein (DHH), partial

• Product Name Alternative:

  (DHH) (HHG-3)

• Abbreviation:

  Recombinant Human DHH protein, partial

• Gene Name:

  DHH

• UniProt:

  O43323

• Expression Region:

  51-158AA

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  GVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNK

• Tag:

  N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Others

• Relevance:

  [Desert hedgehog protein]: The C-terminal part of the desert hedgehog protein precursor displays an autoproteolysis and a cholesterol transferase activity . Both activities result in the cleavage of the full-length protein into two parts (N-product and C-product) followed by the covalent attachment of a cholesterol moiety to the C-terminal of the newly generated N-product . Both activities occur in the reticulum endoplasmic . Functions in cell-cell mediated juxtacrine signaling . Promotes endothelium integrity . Binds to PTCH1 receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes in endothelial cells . In Schwann cells, controls the development of the peripheral nerve sheath and the transition of mesenchymal cells to form the epithelium-like structure of the perineurial tube . [Desert hedgehog protein N-product]: The dually lipidated desert hedgehog protein N-product is essential for a variety of patterning events during development . Binds to the patched (PTCH1) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes . Required for normal testis development and spermatogenesis, namely for the formation of adult-type Leydig cells and normal development of peritubular cells and seminiferous tubules . Activates primary cilia signaling on neighboring valve interstitial cells through a paracrine mechanism . May induce motor neurons in lateral neural tube and may have a polarizing activity . Prevents the desert hedgehog protein precursor binding to PTCH1 .

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  42.6 kDa

• References & Citations:

  "Full-length Dhh and N-terminal Shh act as competitive antagonists to regulate angiogenesis and vascular permeability." Hollier P.L., Chapouly C., Diop A., Guimbal S., Cornuault L., Gadeau A.P., Renault M.A. Cardiovasc. Res. 117:2489-2501 (2021)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial