Recombinant Human C-C motif chemokine 26 protein (CCL26) (Active)

• Product Name Alternative:

  CC chemokine IMAC, Macrophage inflammatory protein 4-alpha, MIP-4-alpha, Small-inducible cytokine A26, Thymic stroma chemokine-1

• Abbreviation:

  Recombinant Human CCL26 protein (Active)

• Gene Name:

  CCL26

• UniProt:

  Q9Y258

• Expression Region:

  24-94aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  TRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL

• Tag:

  Tag-Free

• Type:

  Active Protein & In Stock Protein

• Source:

  E.Coli

• Field of Research:

  Immunology

• Relevance:

  Chemotactic for eosinophils and basophils. Binds to CCR3.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  >97% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human CCR3 transfected HEK293 cells is in a concentration range of 0.5- 2.0 μg/ml.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 µm filtered PBS, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  Chemoattractant for eosinophils and basophils

• Molecular Weight:

  8.4 kDa

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein