Recombinant Human Tetraspanin-7 (TSPAN7), partial

• Product Name Alternative:

  Cell surface glycoprotein A15Membrane component chromosome X surface marker 1T-cell acute lymphoblastic leukemia-associated antigen 1 ; TALLA-1Transmembrane 4 superfamily member 2; ; CD231

• Abbreviation:

  Recombinant Human TSPAN7 protein, partial

• Gene Name:

  TSPAN7

• UniProt:

  P41732

• Expression Region:

  113-213aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM

• Tag:

  N-terminal 6xHis-tagged

• Source:

  Yeast

• Field of Research:

  Immunology

• Relevance:

  May be involved in cell proliferation and cell motility.

• Endotoxin:

  Not test

• Purity:

  Greater than 90% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Lyophilized

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Function:

  May be involved in cell proliferation and cell motility.

• Molecular Weight:

  14.5 kDa

• References & Citations:

  Isolation of a novel cDNA clone showing marked similarity to ME491/CD63 superfamily.Emi N., Kitaori K., Seto M., Ueda R., Saito H., Takahashi T.Immunogenetics 37:193-198 (1993)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial