Recombinant Human Glypican-3 (GPC3), partial (Active)

• Product Name Alternative:

  Glypican-3; GTR2-2; Intestinal protein OCI-5; MXR7 [Cleaved into: Glypican-3 alpha subunit; Glypican-3 beta subunit]

• Abbreviation:

  Recombinant Human GPC3 protein, partial (Active)

• Gene Name:

  GPC3

• UniProt:

  P51654

• Expression Region:

  524-563aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  AELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHSPLK

• Tag:

  N-terminal mFc-tagged

• Source:

  Mammalian cell

• Field of Research:

  Cancer

• Relevance:

  Cell surface proteoglycan (PubMed:14610063) . Negatively regulates the hedgehog signaling pathway when attached via the GPI-anchor to the cell surface by competing with the hedgehog receptor PTC1 for binding to hedgehog proteins (By similarity) . Binding to the hedgehog protein SHH triggers internalization of the complex by endocytosis and its subsequent lysosomal degradation (By similarity) . Positively regulates the canonical Wnt signaling pathway by binding to the Wnt receptor Frizzled and stimulating the binding of the Frizzled receptor to Wnt ligands (PubMed:16227623, PubMed:24496449) . Positively regulates the non-canonical Wnt signaling pathway (By similarity) . Binds to CD81 which decreases the availability of free CD81 for binding to the transcriptional repressor HHEX, resulting in nuclear translocation of HHEX and transcriptional repression (By similarity) . Inhibits the dipeptidyl peptidase activity of DPP4 (PubMed:17549790) . Plays a role in limb patterning and skeletal development by controlling the cellular response to BMP4 (By similarity) . Modulates the effects of growth factors BMP2, BMP7 and FGF7 on renal branching morphogenesis (By similarity) . Required for coronary vascular development (By similarity) . Plays a role in regulating cell movements during gastrulation (By similarity) . {ECO:0000250|UniProtKB:Q6V9Y8, ECO:0000250|UniProtKB:Q8CFZ4, ECO:0000269|PubMed:14610063, ECO:0000269|PubMed:16227623, ECO:0000269|PubMed:17549790, ECO:0000269|PubMed:24496449}.

• Endotoxin:

  Less than 1.0 EU/ug as determined by LAL method.

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  1Measured by its binding ability in a functional ELISA. Immobilized Human GPC3 at 2 μg/mL can bind Anti-GPC3 recombinant antibody (CSB-RA009705A1HU) . The EC50 is 0.2007-0.2567 ng/mL. 2Measured by its binding ability in a functional ELISA. Immobilized Human GPC3 at 2 μg/mL can bind Anti-GPC3 recombinant antibody (CSB-RA009705MA2HU) . The EC50 is 0.3261-0.3657 ng/mL.

• Form:

  Lyophilized

• Buffer:

  Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  32.1 kDa

• References & Citations:

  Expression of the Glypican-3 protein in hepatoma cells. Grozdanov P.N., Yovchev M.I., Dabeva M.D. Submitted to EMBL/GenBank/DDBJ databases (JAN-2006)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial