Recombinant Human Hemojuvelin (HJV) (Active)

CAT:
399-GTR17011233
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Hemojuvelin (HJV) (Active)

  • Product Name Alternative:

    Hemojuvelin; Hemochromatosis type 2 protein; Hemojuvelin BMP coreceptor; RGM domain family member C

  • Abbreviation:

    Recombinant Human HJV protein (Active)

  • Gene Name:

    HJV

  • UniProt:

    Q6ZVN8

  • Expression Region:

    36-400aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    QCKILRCNAEYVSSTLSLRGGGSSGALRGGGGGGRGGGVGSGGLCRALRSYALCTRRTARTCRGDLAFHSAVHGIEDLMIQHNCSRQGPTAPPPPRGPALPGAGSGLPAPDPCDYEGRFSRLHGRPPGFLHCASFGDPHVRSFHHHFHTCRVQGAWPLLDNDFLFVQATSSPMALGANATATRKLTIIFKNMQECIDQKVYQAEVDNLPVAFEDGSINGGDRPGGSSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSAEQDLQLCVGGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPSD

  • Tag:

    C-terminal 10xHis-tagged

  • Type:

    Active Protein & In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Cancer

  • Relevance:

    Acts as a bone morphogenetic protein (BMP) coreceptor (PubMed:18976966) . Through enhancement of BMP signaling regulates hepcidin (HAMP) expression and regulates iron homeostasis (PubMed:18976966) . {ECO:0000269|PubMed:18976966}.

  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.

  • Purity:

    Greater than 95% as determined by SDS-PAGE.

  • Activity:

    Yes

  • Bioactivity:

    1Measured by its binding ability in a functional ELISA. Immobilized Human HJV at 2 μg/mL can bind Anti-HJV recombinant antibody (CSB-RA765090MA1HU) . The EC50 is 0.7831-0.8801 ng/mL. 2HJV Recombinant Monoclonal Antibody (CSB-RA765090MA1HU) captured on Protein A Chip can bind Recombinant Human HJV with an affinity constant of 0.973 nM as detected by MetaSPR Assay (WeSPRTM 200) .

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    40.6 kDa

  • References & Citations:

    Mutations in HFE2 cause iron overload in chromosome 1q-linked juvenile hemochromatosis. Papanikolaou G., Samuels M.E., Ludwig E.H., MacDonald M.L.E., Franchini P.L., Dube M.-P., Andres L., MacFarlane J., Sakellaropoulos N., Goldberg Y.P. Nat. Genet. 36:77-82 (2004)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length of Mature Protein