Recombinant Human Sclerostin (SOST) (Active)

CAT:
399-GTR17011231
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Sclerostin (SOST) (Active)

  • Product Name Alternative:

    Sclerostin

  • Abbreviation:

    Recombinant Human SOST protein (Active)

  • Gene Name:

    SOST

  • UniProt:

    Q9BQB4

  • Expression Region:

    24-213aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    QGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY

  • Tag:

    C-terminal 10xHis-tagged

  • Type:

    Active Protein & In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Cancer

  • Relevance:

    Negative regulator of bone growth that acts through inhibition of Wnt signaling and bone formation. {ECO:0000269|PubMed:15908424}.

  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.

  • Purity:

    Greater than 95% as determined by SDS-PAGE.

  • Activity:

    Yes

  • Bioactivity:

    1Measured by its binding ability in a functional ELISA. Immobilized Human SOST at 2 μg/mL can bind Anti-SOST recombinant antibody (CSB-RA858415MA1HU) . The EC50 is 3.442-3.726 ng/mL. 2SOST Recombinant Monoclonal Antibody (CSB-RA858415MA1HU) captured on Protein A Chip can bind Recombinant Human SOST with an affinity constant of 0.324 nM as detected by MetaSPR Assay (WeSPRTM 200) .

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    22.9 kDa

  • References & Citations:

    DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage. Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Nusbaum C. Nature 440:1045-1049 (2006)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length of Mature Protein