Recombinant Human Arginase-1 (ARG1) (Active)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
Recombinant Human Arginase-1 (ARG1) (Active)
Product Name Alternative:
Arginase-1; EC 3.5.3.1; Liver-type arginase; Type I arginase
Abbreviation:
Recombinant Human ARG1 protein (Active)
Gene Name:
ARG1
UniProt:
P05089
Expression Region:
1-322aa
Organism:
Homo sapiens (Human)
Target Sequence:
MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
Tag:
C-terminal 10xHis-tagged
Type:
Active Protein & In Stock Protein
Source:
Mammalian cell
Field of Research:
Cancer
Relevance:
Key element of the urea cycle converting L-arginine to urea and L-ornithine, which is further metabolized into metabolites proline and polyamides that drive collagen synthesis and bioenergetic pathways critical for cell proliferation, respectively; the urea cycle takes place primarily in the liver and, to a lesser extent, in the kidneys.Curated Functions in L-arginine homeostasis in nonhepatic tissues characterized by the competition between nitric oxide synthase (NOS) and arginase for the available intracellular substrate arginine. Arginine metabolism is a critical regulator of innate and adaptive immune responses. Involved in an antimicrobial effector pathway in polymorphonuclear granulocytes (PMN) . Upon PMN cell death is liberated from the phagolysosome and depletes arginine in the microenvironment leading to suppressed T cell and natural killer (NK) cell proliferation and cytokine secretion (PubMed:15546957, PubMed:16709924, PubMed:19380772) . In group 2 innate lymphoid cells (ILC2s) promotes acute type 2 inflammation in the lung and is involved in optimal ILC2 proliferation but not survival (By similarity) . In humans, the immunological role in the monocytic/macrophage/dendritic cell (DC) lineage is unsure.
Endotoxin:
Less than 1.0 EU/μg as determined by LAL method.
Purity:
Greater than 95% as determined by SDS-PAGE.
Activity:
Yes
Bioactivity:
1Measured by its binding ability in a functional ELISA. Immobilized Human ARG1 at 2 μg/mL can bind Anti-ARG1 recombinant antibody (CSB-RA002005MA1HU) . The EC50 is 2.291-3.018 ng/mL. 2ARG1 Recombinant Monoclonal Antibody (CSB-RA002005MA1HU) captured on Protein A Chip can bind Recombinant Human ARG1 with an affinity constant of 0.918 nM as detected by MetaSPR Assay (WeSPRTM 200) .
Form:
Lyophilized powder
Buffer:
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight:
36.2 kDa
References & Citations:
The DNA sequence and analysis of human chromosome 6. Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Beck S. Nature 425:805-811 (2003)
Storage Conditions:
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length:
Full Length