Recombinant Human Tumor-associated calcium signal transducer 2 (TACSTD2), partial, Biotinylated (Active)

• Product Name Alternative:

  Tumor-associated calcium signal transducer 2; Cell surface glycoprotein Trop-2; Membrane component chromosome 1 surface marker 1; Pancreatic carcinoma marker protein GA733-1

• Abbreviation:

  Recombinant Human TACSTD2 protein, partial, Biotinylated (Active)

• Gene Name:

  TACSTD2

• UniProt:

  P09758

• Expression Region:

  31-274aa

• Organism:

  Homo sapiens (Human)

• Target Sequence:

  QDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

• Tag:

  C-terminal 10xHis-Avi-tagged

• Type:

  Active Protein & In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Cancer

• Relevance:

  May function as a growth factor receptor.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  1Measured by its binding ability in a functional ELISA. Immobilized Anti-TACSTD2 recombinant antibody (CSB-RA023072MA1HU) at 2 μg/mL can bind Human TACSTD2. The EC50 is 11.22-13.11 ng/mL. 2TACSTD2 Recombinant Monoclonal Antibody (CSB-RA023072MA1HU) captured on Protein A Chip can bind Human TACSTD2 with an affinity constant of 2.52 nM as detected by MetaSPR Assay (WeSPRTM 200) .

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  31.1 kDa

• References & Citations:

  The DNA sequence and biological annotation of human chromosome 1. Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Bentley D.R. Nature 441:315-321 (2006)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial