Recombinant Human Interleukin-3 receptor subunit alpha (IL3RA), partial (Active)

CAT:
399-GTR17011470
Size:
20 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Human Interleukin-3 receptor subunit alpha (IL3RA), partial (Active)

  • Product Name Alternative:

    Interleukin-3 receptor subunit alpha; IL-3 receptor subunit alpha; IL-3R subunit alpha; IL-3R-alpha; IL-3RA; CD antigen CD123

  • Abbreviation:

    Recombinant Human IL3RA protein, partial (Active)

  • Gene Name:

    IL3RA

  • UniProt:

    P26951

  • Expression Region:

    19-305aa

  • Organism:

    Homo sapiens (Human)

  • Target Sequence:

    TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR

  • Tag:

    C-terminal 10xHis-tagged

  • Type:

    Active Protein & In Stock Protein

  • Source:

    Mammalian cell

  • Field of Research:

    Cancer

  • Relevance:

    Cell surface receptor for IL3 expressed on hematopoietic progenitor cells, monocytes and B-lymphocytes that controls the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells (PubMed:10527461) . Ligand stimulation rapidly induces hetrodimerization with IL3RB, phosphorylation and enzyme activity of effector proteins such as JAK2 and PI3K that play a role in signaling cell proliferation and differentiation. Activation of JAK2 leads to STAT5-mediated transcriptional program (By similarity) . {ECO:0000250|UniProtKB:P26952, ECO:0000269|PubMed:10527461, ECO:0000269|PubMed:29374162}.

  • Endotoxin:

    Less than 1.0 EU/μg as determined by LAL method.

  • Purity:

    Greater than 90% as determined by SDS-PAGE.

  • Activity:

    Yes

  • Bioactivity:

    1Measured by its binding ability in a functional ELISA.Immobilized Human IL3RA at 2 μg/mL can bind Anti-IL3RA recombinant antibody (CSB-RA011658MA1HU) .The EC50 is 1.254-1.412 ng/mL. 2IL3RA Recombinant Monoclonal Antibody (CSB-RA011658MA1HU) captured on Protein A Chip can bind Human IL3RA with an affinity constant of 0.202 nM as detected by MetaSPR Assay (WeSPRTM 200) .

  • Form:

    Lyophilized powder

  • Buffer:

    Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    34.5 kDa

  • References & Citations:

    A new isoform of IL-3 receptor alpha with novel differentiation activity and high affinity binding mode. Chen J., Olsen J., Ford S., Mirza S., Walker A., Murphy J.M., Young I.G. J. Biol. Chem. 284:5763-5773 (2009)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Partial