Recombinant Mouse Kit ligand (Kitlg), partial (Active)

• Product Name Alternative:

  Kit ligand; Hematopoietic growth factor KL; Mast cell growth factor; MGF; Steel factor; Stem cell factor; SCF; c-Kit ligand [Cleaved into: Soluble KIT ligand; sKITLG]

• Abbreviation:

  Recombinant Mouse Kitlg protein, partial (Active)

• Gene Name:

  Kitlg

• UniProt:

  P20826

• Expression Region:

  26-189aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

• Tag:

  C-terminal hFc1-tagged

• Type:

  Active Protein & In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Immunology

• Relevance:

  Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  1Measured by its binding ability in a functional ELISA.Immobilized Mouse Kit (CSB-MP012375MO1) at 2 μg/mL can bind Mouse Kitlg. The EC50 is 19.35-24.80 ng/mL. 2Recombinant Mouse Kitlg captured on Protein A Chip can bind Recombinant Mouse Kit (CSB-MP012375MO1) with an affinity constant of 15.1 nM as detected by MetaSPR Assay (WeSPRTM 200) .

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  47.2 kDa

• References & Citations:

  The transcriptional landscape of the mammalian genome. Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Hayashizaki Y. Science 309:1559-1563 (2005)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial