Recombinant Mouse Kit ligand (Kitlg), partial (Active)

• Product Name Alternative:

  Kit ligand; Hematopoietic growth factor KL; Mast cell growth factor (MGF) ; Steel factor; Stem cell factor (SCF) ; c-Kit ligand; Soluble KIT ligand (sKITLG) ; KitlgKitl, Mgf, Sl, Slf

• Abbreviation:

  Recombinant Mouse Kitlg protein, partial (Active)

• Gene Name:

  Kitlg

• UniProt:

  P20826

• Expression Region:

  26-189aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  KEICGNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAPKNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVA

• Tag:

  C-terminal 10xHis-tagged

• Type:

  Active Protein & In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Immunology

• Relevance:

  Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  ①The ED50 as determined by the dose-dependent stimulation of the proliferation of TF-1 cells is 1.691-11.94 ng/mL. ②Measured by its binding ability in a functional ELISA.Immobilized Mouse Kitlg at 2 μg/ml can bind Mouse Kit (CSB-MP012375MO) . The EC50 is 15.57-20.95 ng/mL.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  19.8 kDa

• References & Citations:

  Allelic Mutations of KITLG, Encoding KIT Ligand, Cause Asymmetric and Unilateral Hearing Loss and Waardenburg Syndrome Type 2. Baylor-Hopkins Center for Mendelian Genomics Zazo Seco C., Serrao de Castro L., van Nierop J.W., Morin M., Jhangiani S., Verver E.J., Schraders M., Maiwald N., Wesdorp M., Kremer H. Am. J. Hum. Genet. 97:647-660 (2015)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial