Recombinant Tityus bahiensis Toxin Tb2-II

CAT:
399-GTR04836993
Size:
1 mg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Tityus bahiensis Toxin Tb2-II

  • Product Name Alternative:

    P-Mice-Ins-beta* NaTx5.4

  • Abbreviation:

    Recombinant Tityus bahiensis Toxin Tb2-II protein

  • UniProt:

    P60276

  • Expression Region:

    1-62aa

  • Organism:

    Tityus bahiensis (Brazilian scorpion)

  • Target Sequence:

    KEGYAMDHEGCKFSCFIRPSGFCDGYCKTHLKASSGYCAWPACYCYGVPSNIKVWDYATNKC

  • Tag:

    N-terminal 10xHis-tagged and C-terminal Myc-tagged

  • Type:

    In Stock Protein

  • Source:

    Baculovirus

  • Field of Research:

    Others

  • Relevance:

    Beta toxins bind voltage-independently at site-4 of sodium channels and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing . This toxin is active against both mammals and insects.

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    10.8 kDa

  • References & Citations:

    "Purification, amino-acid sequence and partial characterization of two toxins with anti-insect activity from the venom of the South American scorpion Tityus bahiensis (Buthidae) ." Pimenta A.M.C., Martin-Eauclaire M.-F., Rochat H., Figueiredo S.G., Kalapothakis E., Afonso L.C.C., De Lima M.E. Toxicon 39:1009-1019 (2001)

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length