Recombinant Tityus serrulatus Alpha-mammal toxin Ts2

• Product Name Alternative:

  P-Mice-beta* NaTx5.1 (Tityustoxin II) (Toxin T1-IV) (TsTX III-8) (TsTX-III)

• Abbreviation:

  Recombinant Tityus serrulatus Alpha-mammal toxin Ts2 protein

• UniProt:

  P68410

• Expression Region:

  1-62aa

• Organism:

  Tityus serrulatus (Brazilian scorpion)

• Target Sequence:

  KEGYAMDHEGCKFSCFIRPAGFCDGYCKTHLKASSGYCAWPACYCYGVPDHIKVWDYATNKC

• Tag:

  N-terminal 10xHis-tagged and C-terminal Myc-tagged

• Type:

  In Stock Protein

• Source:

  Baculovirus

• Field of Research:

  Others

• Relevance:

  Alpha toxins bind voltage-independently at site-3 of sodium channels and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. This toxin acts on Nav1.2/SCN2A, Nav1.3/SCN3A, Nav1.5/SCN5A, Nav1.6/SCN8A and Nav1.7/SCN9A voltage-gated sodium channels, with the highest affinity for Nav1.3/SCN3A, followed by Nav1.6/SCN8A and Nav1.7/SCN9A which are affected almost equally. Interestingly, shows a significant shift of the voltage dependence of activation for Nav1.3/SCN3A that is characteristic of beta-toxins . In addition, in presence of LPS, this toxin inhibits the release of NO, IL-6 and TNF-alpha in J774.1 cells . Further, in the absence of LPS, it stimulates the production of the anti-inflammatory cytokine IL-10 . This toxin is active on mammals.

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  10.9 kDa

• References & Citations:

  "The beta-type toxin Ts II from the scorpion Tityus serrulatus: amino acid sequence determination and assessment of biological and antigenic properties." Mansuelle P., Martin-Eauclaire M.-F., Chavez-Olortegui C., de Lima M.E., Rochat H., Granier C. Nat. Toxins 1:119-125 (1992)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length