Recombinant Dog C-C motif chemokine 17 (CCL17), Biotinylated

• Product Name Alternative:

  (CC chemokine TARC) (Small-inducible cytokine A17) (Thymus and activation-regulated chemokine)

• Abbreviation:

  Recombinant Dog CCL17 protein, Biotinylated

• Gene Name:

  CCL17

• UniProt:

  Q95N01

• Expression Region:

  24-99aa

• Organism:

  Canis lupus familiaris (Dog) (Canis familiaris)

• Target Sequence:

  ARGTNVGRECCLEYFKGAIPISRLTRWYKTSGECPKDAIVFVTVQGKSICSDPKDKRVKKAVRYLQRTWKGGPQES

• Tag:

  N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged

• Type:

  Developed Protein

• Source:

  E.coli

• Field of Research:

  Immunology

• Relevance:

  Chemotactic factor for t lymphocytes but not monocytes or granulocytes. May play a role in T-cell development in thymus and in trafficking and activation of mature T-cells. Binds to CCR4 and CCR8.

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  56.4 kDa

• References & Citations:

  "Molecular cloning of canine thymus and activation-regulated chemokine (TARC) gene and its expression in various tissues." Maeda S., Mizuno T., Yamashita K., Kurata K., Masuda K., Ohno K., Tsujimoto H. J. Vet. Med. Sci. 63:1035-1038 (2001)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein