Recombinant Bovine viral diarrhea virus Genome polyprotein , partial

• Product Name Alternative:

  Genome polyprotein [Cleaved into: N-terminal protease; N-pro; EC 3.4.22.-; Autoprotease p20) ; Capsid protein C; E (rns) glycoprotein; gp44/48) ; Envelope glycoprotein E1; gp33) ; Envelope glycoprotein E2; gp55) ; p7; Non-structural protein 2-3; Cysteine protease NS2; EC 3.4.22.-; Non-structural protein 2) ; Serine protease NS3; EC 3.4.21.113; EC 3.6.1.15; EC 3.6.4.13; Non-structural protein 3) ; Non-structural protein 4A; NS4A) ; Non-structural protein 4B; NS4B) ; Non-structural protein 5A; NS5A) ; RNA-directed RNA polymerase; EC 2.7.7.48; NS5B) ]

• Abbreviation:

  Recombinant Bovine viral diarrhea virus Genome polyprotein protein, partial

• UniProt:

  Q01499

• Expression Region:

  1-168aa

• Organism:

  Bovine viral diarrhea virus (strain SD-1) (BVDV) (Mucosal disease virus)

• Target Sequence:

  MELITNELLYKTYKQKPVGVEEPVYDQAGNPLFGERGAIHPQSTLKLPHKRGERNVPTSLASLPKRGDCRSGNSKGPVSGIYLKPGPLFYQDYKGPVYHRAPLELFEEGSMCETTKRIGRVTGSDGKLYHIYICIDGCITVKSATRSHQRVLRWVHNRLDCPLWVTSC

• Tag:

  N-terminal 6xHis-tagged

• Type:

  Developed Protein

• Source:

  Yeast

• Field of Research:

  Others

• Relevance:

  Initial binding to target cell probably involves interaction of E with glycosaminoglycans. E1 and/or E2 are responsible of cell attachment with CD46 and subsequent fusion after internalization of the virion by endocytosis.

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  20.4 kDa

• References & Citations:

  "Structure of a pestivirus envelope glycoprotein E2 clarifies its role in cell entry." El Omari K., Iourin O., Harlos K., Grimes J.M., Stuart D.I. Cell Rep 3:30-35 (2013)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial