Recombinant Caenorhabditis elegans Transcription factor elt-2 (elt-2)

CAT:
399-GTR13817236
Size:
100 µg
  • Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
  • Dry Ice Shipment: No

Recombinant Caenorhabditis elegans Transcription factor elt-2 (elt-2)

  • Product Name Alternative:

    GATA-type domain-containing protein elt-2

  • Abbreviation:

    Recombinant Caenorhabditis elegans elt-2 protein

  • Gene Name:

    Elt-2

  • UniProt:

    Q10655

  • Expression Region:

    1-433aa

  • Organism:

    Caenorhabditis elegans

  • Target Sequence:

    MDNNYNDNVNGWAEMEPSQPMGGLRLPTQNMDPPEQNNESQLSELPRMKIDNDYASPIERQSVITSGTNNYEPKVETVTSFFHTGIDYSNFGMLDQTTMQPFYPLYSGIPVNTLGTFSGYTNSIYDKPSLYDPSIPTINIPSTYPTVAPTYECVKCSQSCGAGMKAVNGGMMCVNCSTPKTTYSPPVAYSTSLGQPPILEIPSEQPTAKIAKQSSKKSSSSNRGSNGSASRRQGLVCSNCNGTNTTLWRRNAEGDPVCNACGLYFKLHHIPRPTSMKKEGALQTRKRKSKSGDSSTPSTSRARERKFERASSSTEKAQRSSNRRAGSAKADRELSTAAVAAATATYVSHADLYPVSSAAVTLPDQTYSNYYQWNTAATAGLMMVPNDQNYVYAATNYQTGLRPADNIQVHVMPVQDDETKAAARDLEAVDGDS

  • Tag:

    C-terminal 6xHis-tagged

  • Type:

    Developed Protein

  • Source:

    E.coli

  • Field of Research:

    Others

  • Relevance:

    Transcriptional activator that binds to the consensus sequence 5'-[AT]GATA[AG]-3'. Predominantly directs the transcription of intestinal genes such as ges-1, cpr-6, pho-1, ftn-1, vit-2 and lev-11, and itself. Required for gut-specific differentiation, specifically acting with the GATA region-binding transcription factor elt-7 to control normal gene expression and promote normal formation of the intestine. Regulates intestinal gene expression in response to hypoxia to promote longevity. Modulation of longevity may, in part, be the result of regulation of expression of daf-16 isoforms d and f in the intestine. Regulates tissue specific gene expression at basal levels and in response to bacterial infection in the intestine to control innate immunity. Plays a role in the induction of metal-responsive genes, activating gene expression from zinc-activated promoters and iron-dependent promoters and enhancers. May regulate the expression of genes that control sensitivity to oxidative stress, in a mab-3-dependent manner, and osmotic stress, in conjunction with the GATA region-binding transcription factor elt-3. May play a role in sphingolipid signaling by regulating the expression of the sphingosine-1-phosphate degrading enzyme, sphingosine-1-phosphate lyase. May act with the Notch signaling pathway to promote endodermal gene expression. Has a protective role in response to infection by Gram-negative bacteria such as S.enterica, E.coli, P.aeruginosa and B.pseudomallei, Gram-positive bacterium E.faecalis and fungal pathogen C.neoformans. An association with the 26S proteasome regulatory subunit rpt-6, in part, controls gene expression in response to infection by P.aeruginosa. Regulates gene expression during the recovery phase following a bacterial infection. May act with p38-activated transcription factors to control p38 gene induction in response to bacterial infection. Controls lysosome formation in the intestine by controlling lysosomal gene expression

  • Endotoxin:

    Not test

  • Purity:

    Greater than 85% as determined by SDS-PAGE.

  • Activity:

    Not Test

  • Form:

    Liquid or Lyophilized powder

  • Buffer:

    If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

  • Reconstitution:

    We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

  • Molecular Weight:

    54.0 kDa

  • Storage Conditions:

    The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

  • Protein Length:

    Full Length