Recombinant Human cytomegalovirus Viral transcription factor IE2 (UL122), partial

• Product Name Alternative:

  Protein UL122

• Abbreviation:

  Recombinant Human cytomegalovirus UL122 protein, partial

• Gene Name:

  UL122

• UniProt:

  P19893

• Expression Region:

  340-580aa

• Organism:

  Human cytomegalovirus (strain AD169) (HHV-5) (Human herpesvirus 5)

• Target Sequence:

  NIMKDKNTPFCTPNVQTRRGRVKIDEVSRMFRNTNRSLEYKNLPFTIPSMHQVLDEAIKACKTMQVNNKGIQIIYTRNHEVKSEVDAVRCRLGTMCNLALSTPFLMEHTMPVTHPPEVAQRTADACNEGVKAAWSLKELHTHQLCPRSSDYRNMIIHAATPVDLLGALNLCLPLMQKFPKQVMVRIFSTNQGGFMLPIYETAAKAYAVGQFEQPTETPPEDLDTLSLAIEAAIQDLRNKSQ

• Tag:

  C-terminal 6xHis-tagged

• Type:

  In Stock Protein

• Source:

  E.coli

• Field of Research:

  Others

• Relevance:

  Stimulates viral early and late gene expression and thus play a crucial role in the regulation of productive infection. Selectively drives host RNA Pol II transcription initiation at a subset of viral early-late and late promoters without substantially affecting Pol II transcription of expressed host genes. Mechanistically, forms a repressive complex at the major immediate-early promoter region involving direct association with host nucleosomes and TBP. Concerning activation, stimulates transcription by binding nearby, but not within, core promoter regions. In addition, activates quiescent cells to reenter the cell cycle and up-regulates several E2F-responsive genes, which are responsible for pushing the cell into S phase. In S-phase, inhibits cellular DNA synthesis and blocks further cell cycle progression

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid or Lyophilized powder

• Buffer:

  If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  34.1 kDa

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial