Recombinant Mouse Ly6/PLAUR domain-containing protein 3 (Lypd3), partial (Active)

• Product Name Alternative:

  Ly6/PLAUR domain-containing protein 3; GPI-anchored metastasis-associated protein C4.4A homolog; Lypd3; C4.4a

• Abbreviation:

  Recombinant Mouse Lypd3 protein, partial (Active)

• Gene Name:

  Lypd3

• UniProt:

  Q91YK8

• Expression Region:

  33-287aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  LECYSCVQKADDGCSPHRMKTVKCGPGVDVCTEAVGAVETIHGQFSVAVRGCGSGIPGKNDRGLDLHGLLAFFQLQQCSEDRCNAKLNLTLRGLNPAGNESAYEPNGAECYSCVGLSREKCQGSMPPVVNCYNASGRVYKGCFDGNVTLTAANVTVSLPVRGCVQDETCTRDGVTGPGFTLSGSCCQGPRCNADLRNKTYFSPRIPPLVLLPPPTTAAPSTRAQNSSSTTSTAAPTTTTSIIKPTTAQASHTSPH

• Tag:

  C-terminal 10xHis-tagged

• Type:

  Active Protein & In Stock Protein

• Source:

  Mammalian cell

• Field of Research:

  Cancer

• Relevance:

  Supports cell migration. May be involved in tumor progression (By similarity) .

• Endotoxin:

  Less than 1.0 EU/μg as determined by LAL method.

• Purity:

  Greater than 95% as determined by SDS-PAGE.

• Activity:

  Yes

• Bioactivity:

  Measured by its binding ability in a functional ELISA.Immobilized Mouse Lypd3 at 2 μg/mL can bind Anti-LYPD3 recombinant antibody (CSB-RA013263MA2HU) . The EC50 is 1.995-2.345 ng/mL.

• Form:

  Lyophilized powder

• Buffer:

  Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

• Reconstitution:

  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

• Molecular Weight:

  28.0 kDa

• References & Citations:

  Structural analysis and tissue localization of human C4.4A: a protein homologue of the urokinase receptor. Hansen L.V., Gaardsvoll H., Nielsen B.S., Lund L.R., Danoe K., Jensen O.N., Ploug M. Biochem. Eng. J. 380:845-857 (2004)

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Partial