Recombinant Mouse 1-acyl-sn-glycerol-3-phosphate acyltransferase beta (Agpat2) -Detergent

• Product Name Alternative:

  1-acylglycerol-3-phosphate O-acyltransferase 2;1-AGP acyltransferase 2;1-AGPAT 2; Lysophosphatidic acid acyltransferase beta; LPAAT-beta

• Abbreviation:

  Recombinant Mouse Agpat2 protein-Detergent

• Gene Name:

  Agpat2

• UniProt:

  Q8K3K7

• Expression Region:

  24-278aa

• Organism:

  Mus musculus (Mouse)

• Target Sequence:

  ARFYAKVGLYCVLCLSFSAAASIVCLLRHGGRTVDNMSIISWFVRSFKYVYGLRFEVSGQKKLEVDGPCVIISNHQSILDMMGLMEILPKRCVQIAKRELMFTGPVGLIMYLGGVYFINRQQARTAMSVMADLGDLMVKENLKVWIYPEGTRNDNGDLLPFKKGAFYLAIQAQVPIIPVVYSSFSSFYNVKTKLFTSGTIKVQVLDAVPTNGLTDADVTKLVDTCYQSMRATFLQISQIPQENSAIKEPGVLPAQ

• Tag:

  N-terminal 10xHis-tagged and C-terminal Twin-Strep-tagged

• Type:

  MP-Detergent Transmembrane Protein & Developed Protein

• Source:

  Mammalian cell

• Field of Research:

  Cancer

• Relevance:

  Converts 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone.

• Endotoxin:

  Not test

• Purity:

  Greater than 85% as determined by SDS-PAGE.

• Activity:

  Not Test

• Form:

  Liquid

• Buffer:

  50 mM HEPES, 0.15 M NaCl, 0.05% DDM, 0.01% CHS, pH7.5

• Reconstitution:

  /

• Molecular Weight:

  32.8 kDa

• Storage Conditions:

  The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

• Protein Length:

  Full Length of Mature Protein