Recombinant Human ATP synthase subunit f, mitochondrial (ATP5J2)
- Availability: 24/48H Stock Items & 2 to 6 Weeks non Stock Items.
- Dry Ice Shipment: No
Recombinant Human ATP synthase subunit f, mitochondrial (ATP5J2)
Product Name Alternative:
(ATP synthase membrane subunit f)
Abbreviation:
Recombinant Human ATP5MF protein
Gene Name:
ATP5MF
UniProt:
P56134
Expression Region:
1-94aa
Organism:
Homo sapiens (Human)
Target Sequence:
MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH
Tag:
N-terminal 10xHis-tagged
Type:
CF Transmembrane Protein & In Stock Protein
Source:
In vitro E.coli expression system
Field of Research:
Others
Relevance:
Mitochondrial membrane ATP synthase (F (1) F (0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F (1) - containing the extramembraneous catalytic core and F (0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F (1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F (0) domain. Minor subunit located with subunit a in the membrane.
Endotoxin:
Not test
Purity:
Greater than 90% as determined by SDS-PAGE.
Activity:
Not Test
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight:
12.4 kDa
References & Citations:
"Dimer ribbons of ATP synthase shape the inner mitochondrial membrane." Strauss M., Hofhaus G., Schroder R.R., Kuhlbrandt W. EMBO J 27:1154-1160 (2008)
Storage Conditions:
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length:
Full Length